CAD Antikörper (N-Term)
-
- Target Alle CAD Antikörper anzeigen
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CAD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CAD antibody was raised against the N terminal of CAD
- Aufreinigung
- Affinity purified
- Immunogen
- CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
- Top Product
- Discover our top product CAD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAD Blocking Peptide, catalog no. 33R-1037, is also available for use as a blocking control in assays to test for specificity of this CAD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
- Andere Bezeichnung
- CAD (CAD Produkte)
- Synonyme
- Cpad antikoerper, AU018859 antikoerper, 2410008J01Rik antikoerper, cb456 antikoerper, wu:fc30c12 antikoerper, wu:fc33d01 antikoerper, wu:fc67g02 antikoerper, si:dkey-221h15.3 antikoerper, CAD antikoerper, xcad antikoerper, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antikoerper, CAD antikoerper, Cad antikoerper, cad antikoerper
- Hintergrund
- CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.
- Molekulargewicht
- 243 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process
-