PPP2R5C Antikörper (Middle Region)

Produktnummer ABIN630610

Produktdetails anti-PPP2R5C Antikörper

Target: PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP2R5C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPP2 R2 antibody was raised against the middle region of PPP2 2

Aufreinigung: Affinity purified

Immunogen: PPP2 R2 antibody was raised using the middle region of PPP2 2 corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP2R5C Blocking Peptide, catalog no. 33R-7903, is also available for use as a blocking control in assays to test for specificity of this PPP2R5C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP2R5C

Target: PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))

Andere Bezeichnung: PPP2R5C (PPP2R5C Produkte)

Synonyme: B56G antikoerper, PR61G antikoerper, 2610043M05Rik antikoerper, 2700063L20Rik antikoerper, AI060890 antikoerper, AW545884 antikoerper, C85228 antikoerper, D12Bwg0916e antikoerper, mKIAA0044 antikoerper, b56g antikoerper, ppp2r5c antikoerper, si:dkey-241l7.9 antikoerper, protein phosphatase 2 regulatory subunit B'gamma antikoerper, protein phosphatase 2, regulatory subunit B', gamma antikoerper, protein phosphatase 2 regulatory subunit B', gamma antikoerper, protein phosphatase 2, regulatory subunit B', gamma b antikoerper, protein phosphatase 2, regulatory subunit B', gamma a antikoerper, PPP2R5C antikoerper, Ppp2r5c antikoerper, ppp2r5c antikoerper, ppp2r5c.L antikoerper, ppp2r5cb antikoerper, ppp2r5ca antikoerper

Hintergrund: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg