HNF4A Antikörper (Middle Region)
-
- Target Alle HNF4A Antikörper anzeigen
- HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNF4A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HNF4 A antibody was raised against the middle region of HNF4
- Aufreinigung
- Affinity purified
- Immunogen
- HNF4 A antibody was raised using the middle region of HNF4 corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI
- Top Product
- Discover our top product HNF4A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNF4A Blocking Peptide, catalog no. 33R-5264, is also available for use as a blocking control in assays to test for specificity of this HNF4A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))
- Andere Bezeichnung
- HNF4A (HNF4A Produkte)
- Synonyme
- HNF4A antikoerper, HNF4alpha antikoerper, CG9310 antikoerper, DmHNF4 antikoerper, Dmel\\CG9310 antikoerper, HNF-4 antikoerper, HNF-4(D) antikoerper, HNF4 antikoerper, Hnf-4 antikoerper, Hnf-4h antikoerper, NR2A4 antikoerper, dHNF-4 antikoerper, dHNF4 antikoerper, Hnf4 antikoerper, Hnf4alpha antikoerper, MODY1 antikoerper, Nr2a1 antikoerper, Tcf14 antikoerper, HNF4a7 antikoerper, HNF4a8 antikoerper, HNF4a9 antikoerper, MODY antikoerper, NR2A1 antikoerper, NR2A21 antikoerper, TCF antikoerper, TCF14 antikoerper, HNF-4alpha antikoerper, fb58h09 antikoerper, id:ibd1279 antikoerper, wu:fb58h09 antikoerper, hnf4 antikoerper, nr2a1 antikoerper, hepatocyte nuclear factor 4 alpha antikoerper, Hepatocyte nuclear factor 4 antikoerper, hepatic nuclear factor 4, alpha antikoerper, hepatocyte nuclear factor 4, alpha antikoerper, hepatocyte nuclear factor 4 alpha S homeolog antikoerper, HNF4A antikoerper, hnf4a antikoerper, Hnf4 antikoerper, Hnf4a antikoerper, hnf4a.S antikoerper
- Hintergrund
- The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, Cell-Cell Junction Organization, Regulation of Carbohydrate Metabolic Process
-