HNF4A Antikörper (Middle Region)

Produktnummer ABIN630607

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HNF4A in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für HNF4A Antikörper (Middle Region) (ABIN630607)

Target: HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNF4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HNF4A Antikörper

Bindungsspezifität: Middle Region

Spezifität: HNF4 A antibody was raised against the middle region of HNF4

Aufreinigung: Affinity purified

Immunogen: HNF4 A antibody was raised using the middle region of HNF4 corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNF4A Blocking Peptide, (ABIN5614035), is also available for use as a blocking control in assays to test for specificity of this HNF4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNF4A

Target: HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))

Andere Bezeichnung: HNF4A

Hintergrund: The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: AMPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, Cell-Cell Junction Organization, Regulation of Carbohydrate Metabolic Process