MBD1 Antikörper (Middle Region)
-
- Target Alle MBD1 Antikörper anzeigen
- MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MBD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MBD1 antibody was raised against the middle region of MBD1
- Aufreinigung
- Affinity purified
- Immunogen
- MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ
- Top Product
- Discover our top product MBD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MBD1 Blocking Peptide, catalog no. 33R-1727, is also available for use as a blocking control in assays to test for specificity of this MBD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))
- Andere Bezeichnung
- MBD1 (MBD1 Produkte)
- Synonyme
- CXXC3 antikoerper, PCM1 antikoerper, RFT antikoerper, Cxxc3 antikoerper, CCDC11 antikoerper, methyl-CpG binding domain protein 1 antikoerper, MBD1 antikoerper, Mbd1 antikoerper
- Hintergrund
- MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus.
- Molekulargewicht
- 65 kDa (MW of target protein)
-