Tropomyosin Antikörper
-
- Target Alle Tropomyosin (TPM1) Antikörper anzeigen
- Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tropomyosin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED
- Top Product
- Discover our top product TPM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tropomyosin 1 Blocking Peptide, catalog no. 33R-5082, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))
- Andere Bezeichnung
- Tropomyosin 1 (TPM1 Produkte)
- Synonyme
- alpha-fTM antikoerper, Tm7 antikoerper, tpm1 antikoerper, MGC84844 antikoerper, AA986836 antikoerper, AI854628 antikoerper, TM2 antikoerper, Tm3 antikoerper, Tmpa antikoerper, Tpm-1 antikoerper, alpha-TM antikoerper, Alpha-tm antikoerper, Tma2 antikoerper, Tmsa antikoerper, TPM1 antikoerper, fb37a09 antikoerper, tm antikoerper, wu:fb37a09 antikoerper, CH1 antikoerper, alpha-tm antikoerper, alpha-tropomyosin antikoerper, C15orf13 antikoerper, CMD1Y antikoerper, CMH3 antikoerper, HTM-alpha antikoerper, TMSA antikoerper, TPMA antikoerper, Tm1 antikoerper, zgc:171719 antikoerper, zgc:55951 antikoerper, zgc:77009 antikoerper, tropomyosin 1 (alpha) antikoerper, tropomyosin antikoerper, tropomyosin 1 antikoerper, tropomyosin 1, alpha antikoerper, alpha-tropomyosin antikoerper, tropomyosin 1 L homeolog antikoerper, TPM1 antikoerper, tm7 antikoerper, Tpm1 antikoerper, tpma antikoerper, tpm1.L antikoerper, Smp_044010.2 antikoerper, LOC732984 antikoerper, tpm1 antikoerper
- Hintergrund
- TPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-