Tropomyosin Antikörper

Produktnummer ABIN630583

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Tropomyosin in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für Tropomyosin Antikörper (ABIN630583)

Target: Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tropomyosin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tropomyosin Antikörper

Aufreinigung: Affinity purified

Immunogen: Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tropomyosin 1 Blocking Peptide, (ABIN940468), is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tropomyosin

Target: Tropomyosin (TPM1) (Tropomyosin 1 (Alpha) (TPM1))

Andere Bezeichnung: Tropomyosin 1

Hintergrund: TPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization