TFAM Antikörper (Middle Region)
-
- Target Alle TFAM Antikörper anzeigen
- TFAM (Transcription Factor A, Mitochondrial (TFAM))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TFAM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TFAM antibody was raised against the middle region of TFAM
- Aufreinigung
- Affinity purified
- Immunogen
- TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
- Top Product
- Discover our top product TFAM Primärantikörper
-
anti-Transcription Factor A, Mitochondrial (TFAM) (N-Term) antibody
TFAM Reaktivität: Human, Maus, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Schwein, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 43-243) antibodyTFAM Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 216-246), (C-Term) antibodyTFAM Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB27631 unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 1-220) antibodyTFAM Reaktivität: Human WB, IHC, IF, ChIP Wirt: Kaninchen Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) antibodyKO Validated TFAM Reaktivität: Human WB, IF, IP, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 1-246) antibodyTFAM Reaktivität: Human WB, IF, IHC (p) Wirt: Maus Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 227-246), (C-Term) antibodyTFAM Reaktivität: Human WB, ICC, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 1-246) antibodyTFAM Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) antibodyTFAM Reaktivität: Human WB, IHC, IF, ChIP Wirt: Kaninchen Monoclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 216-246) antibodyTFAM Reaktivität: Human WB, IHC, ELISA, IF, FACS Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TFAM Blocking Peptide, catalog no. 33R-4982, is also available for use as a blocking control in assays to test for specificity of this TFAM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFAM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TFAM (Transcription Factor A, Mitochondrial (TFAM))
- Andere Bezeichnung
- TFAM (TFAM Produkte)
- Synonyme
- tcf6 antikoerper, mttf1 antikoerper, mttfa antikoerper, tcf6l1 antikoerper, tcf6l2 antikoerper, tcf6l3 antikoerper, mttfa-A antikoerper, xl-mtTFA antikoerper, MGC153358 antikoerper, zgc:153358 antikoerper, MTTF1 antikoerper, MTTFA antikoerper, TCF6 antikoerper, TCF6L1 antikoerper, TCF6L2 antikoerper, TCF6L3 antikoerper, AI661103 antikoerper, Hmgts antikoerper, mtTFA antikoerper, tsHMG antikoerper, Mttfa antikoerper, transcription factor A, mitochondrial antikoerper, transcription factor A, mitochondrial L homeolog antikoerper, TFAM antikoerper, tfam.L antikoerper, tfam antikoerper, Tfam antikoerper
- Hintergrund
- TFAM is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-
