NR1H4 Antikörper (Middle Region)

Produktnummer ABIN630514

Produktdetails anti-NR1H4 Antikörper

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR1H4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR1 H4 antibody was raised against the middle region of NR1 4

Aufreinigung: Affinity purified

Immunogen: NR1 H4 antibody was raised using the middle region of NR1 4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR1H4 Blocking Peptide, catalog no. 33R-8322, is also available for use as a blocking control in assays to test for specificity of this NR1H4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR1H4

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Andere Bezeichnung: NR1H4 (NR1H4 Produkte)

Synonyme: zgc:110190 antikoerper, zgc:92742 antikoerper, NR1H4 antikoerper, BAR antikoerper, FXR antikoerper, HRR-1 antikoerper, HRR1 antikoerper, RIP14 antikoerper, AI957360 antikoerper, Fxr antikoerper, Rxrip14 antikoerper, nuclear receptor subfamily 1, group H, member 5 S homeolog antikoerper, nuclear receptor subfamily 1, group H, member 4 antikoerper, nuclear receptor subfamily 1 group H member 4 antikoerper, nr1h5.S antikoerper, nr1h4 antikoerper, NR1H4 antikoerper, Nr1h4 antikoerper

Hintergrund: NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Carbohydrate Metabolic Process