NR0B1 Antikörper (Middle Region)
-
- Target Alle NR0B1 Antikörper anzeigen
- NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NR0B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NR0 B1 antibody was raised against the middle region of NR0 1
- Aufreinigung
- Affinity purified
- Immunogen
- NR0 B1 antibody was raised using the middle region of NR0 1 corresponding to a region with amino acids FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS
- Top Product
- Discover our top product NR0B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NR0B1 Blocking Peptide, catalog no. 33R-2852, is also available for use as a blocking control in assays to test for specificity of this NR0B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))
- Andere Bezeichnung
- NR0B1 (NR0B1 Produkte)
- Synonyme
- DAX antikoerper, NR0B1 antikoerper, dax1 antikoerper, AHC antikoerper, AHCH antikoerper, AHX antikoerper, DAX-1 antikoerper, DAX1 antikoerper, DSS antikoerper, GTD antikoerper, HHG antikoerper, NROB1 antikoerper, SRXY2 antikoerper, Ahc antikoerper, Ahch antikoerper, Dax1 antikoerper, nuclear receptor subfamily 0 group B member 1 antikoerper, nuclear receptor subfamily 0, group B, member 1 antikoerper, nuclear receptor subfamily 0 group B member 1 L homeolog antikoerper, NR0B1 antikoerper, nr0b1 antikoerper, nr0b1.L antikoerper, Nr0b1 antikoerper
- Hintergrund
- NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-