NR4A1 Antikörper (Middle Region)

Produktnummer ABIN630504

Produktdetails anti-NR4A1 Antikörper

Target: NR4A1 (Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR4A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR4 A1 antibody was raised against the middle region of NR4 1

Aufreinigung: Affinity purified

Immunogen: NR4 A1 antibody was raised using the middle region of NR4 1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR4A1 Blocking Peptide, catalog no. 33R-3032, is also available for use as a blocking control in assays to test for specificity of this NR4A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR4A1

Target: NR4A1 (Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1))

Andere Bezeichnung: NR4A1 (NR4A1 Produkte)

Synonyme: GFRP1 antikoerper, HMR antikoerper, N10 antikoerper, NAK-1 antikoerper, NGFIB antikoerper, NP10 antikoerper, NUR77 antikoerper, TR3 antikoerper, NGFI-B antikoerper, Gfrp antikoerper, Hbr-1 antikoerper, Hbr1 antikoerper, Hmr antikoerper, TIS1 antikoerper, nur77 antikoerper, Ngfi-b antikoerper, Nur77 antikoerper, nuclear receptor subfamily 4 group A member 1 antikoerper, nuclear receptor subfamily 4, group A, member 1 antikoerper, NR4A1 antikoerper, Nr4a1 antikoerper

Hintergrund: NR4A1 encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Steroid Hormone Mediated Signaling Pathway