CYP3A7 Antikörper (Middle Region)
-
- Target Alle CYP3A7 Antikörper anzeigen
- CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP3A7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP3 A7 antibody was raised against the middle region of CYP3 7
- Aufreinigung
- Purified
- Immunogen
- CYP3 A7 antibody was raised using the middle region of CYP3 7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
- Top Product
- Discover our top product CYP3A7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP3A7 Blocking Peptide, catalog no. 33R-4668, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))
- Andere Bezeichnung
- CYP3A7 (CYP3A7 Produkte)
- Synonyme
- CP37 antikoerper, CYPIIIA7 antikoerper, P450-HFLA antikoerper, cytochrome P450, family 3, subfamily A, polypeptide 7 antikoerper, cytochrome P450 family 3 subfamily A member 7 antikoerper, CYP3A7 antikoerper
- Hintergrund
- CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-