CA4 Antikörper (Middle Region)

Produktnummer ABIN630435

Produktdetails anti-CA4 Antikörper

Target: CA4 (Carbonic Anhydrase IV (CA4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carbonic Anhydrase IV antibody was raised against the middle region of CA4

Aufreinigung: Purified

Immunogen: Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1946, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA4

Target: CA4 (Carbonic Anhydrase IV (CA4))

Andere Bezeichnung: Carbonic Anhydrase IV (CA4 Produkte)

Synonyme: CAIV antikoerper, Car4 antikoerper, RP17 antikoerper, AW456718 antikoerper, Ca4 antikoerper, ca4 antikoerper, caiv antikoerper, car4 antikoerper, rp17 antikoerper, CA4 antikoerper, zgc:171842 antikoerper, carbonic anhydrase 4 antikoerper, carbonic anhydrase 4 S homeolog antikoerper, carbonic anhydrase IV a antikoerper, CA4 antikoerper, Car4 antikoerper, ca4 antikoerper, ca4.S antikoerper, Ca4 antikoerper, ca4a antikoerper

Hintergrund: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

Molekulargewicht: 34 kDa (MW of target protein)