SLC6A8 Antikörper
-
- Target Alle SLC6A8 Antikörper anzeigen
- SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC6A8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
- Top Product
- Discover our top product SLC6A8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC6A8 Blocking Peptide, catalog no. 33R-1670, is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))
- Andere Bezeichnung
- SLC6A8 (SLC6A8 Produkte)
- Synonyme
- SLC6A8 antikoerper, chot1 antikoerper, crtr antikoerper, creaT antikoerper, CHOT1 antikoerper, CHT1 antikoerper, CRT antikoerper, CT1 antikoerper, AA589632 antikoerper, CRTR antikoerper, Creat antikoerper, CCDS1 antikoerper, solute carrier family 6 member 8 antikoerper, sodium- and chloride-dependent creatine transporter 1 antikoerper, solute carrier family 6 (neurotransmitter transporter), member 8 antikoerper, solute carrier family 6 (neurotransmitter transporter, creatine), member 8 antikoerper, SLC6A8 antikoerper, LOC473853 antikoerper, slc6a8 antikoerper, LOC100440816 antikoerper, Slc6a8 antikoerper
- Hintergrund
- SLC6A8 is required for the uptake of creatine in muscles and brain.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, ER-Nucleus Signaling, Unfolded Protein Response
-