SLC16A1 Antikörper
-
- Target Alle SLC16A1 Antikörper anzeigen
- SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC16A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC16 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN
- Top Product
- Discover our top product SLC16A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC16A1 Blocking Peptide, catalog no. 33R-4596, is also available for use as a blocking control in assays to test for specificity of this SLC16A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))
- Andere Bezeichnung
- SLC16A1 (SLC16A1 Produkte)
- Synonyme
- HHF7 antikoerper, MCT antikoerper, MCT1 antikoerper, MCT1a antikoerper, cb517 antikoerper, zgc:55682 antikoerper, slc16a1 antikoerper, MGC52993 antikoerper, SLC16A1 antikoerper, DKFZp469B1212 antikoerper, AL022710 antikoerper, Mct1 antikoerper, RATMCT1 antikoerper, RNMCT1 antikoerper, solute carrier family 16 member 1 antikoerper, solute carrier family 16 (monocarboxylate transporter), member 1b antikoerper, solute carrier family 16 member 1 S homeolog antikoerper, solute carrier family 16 (monocarboxylic acid transporters), member 1 antikoerper, SLC16A1 antikoerper, slc16a1b antikoerper, slc16a1.S antikoerper, Slc16a1 antikoerper
- Hintergrund
- SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-