MUC1 Antikörper (C-Term)
-
- Target Alle MUC1 Antikörper anzeigen
- MUC1 (Mucin 1 (MUC1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MUC1 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- MUC1 antibody was raised against the C terminal of MUC1
- Aufreinigung
- Purified
- Immunogen
- MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
- Top Product
- Discover our top product MUC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MUC1 Blocking Peptide, catalog no. 33R-8143, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUC1 (Mucin 1 (MUC1))
- Andere Bezeichnung
- MUC1 (MUC1 Produkte)
- Synonyme
- CA 15-3 antikoerper, CD227 antikoerper, EMA antikoerper, H23AG antikoerper, KL-6 antikoerper, MAM6 antikoerper, MCKD1 antikoerper, MUC-1 antikoerper, MUC-1/SEC antikoerper, MUC-1/X antikoerper, MUC1/ZD antikoerper, PEM antikoerper, PEMT antikoerper, PUM antikoerper, Muc-1 antikoerper, mucin 1, cell surface associated antikoerper, mucin 1, transmembrane antikoerper, MUC1 antikoerper, Muc1 antikoerper
- Hintergrund
- MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-