SLC22A1 Antikörper
-
- Target Alle SLC22A1 Antikörper anzeigen
- SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SLC22 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
- Top Product
- Discover our top product SLC22A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A1 Blocking Peptide, catalog no. 33R-5413, is also available for use as a blocking control in assays to test for specificity of this SLC22A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))
- Andere Bezeichnung
- SLC22A1 (SLC22A1 Produkte)
- Synonyme
- SLC22A1 antikoerper, OCT1 antikoerper, HOCT1 antikoerper, oct1_cds antikoerper, Lx1 antikoerper, Oct1 antikoerper, Orct antikoerper, Orct1 antikoerper, Roct1 antikoerper, SLC22A2 antikoerper, solute carrier family 22 member 1 antikoerper, solute carrier family 22 (organic cation transporter), member 1 antikoerper, solute carrier family 22 member 2-like antikoerper, SLC22A1 antikoerper, Slc22a1 antikoerper, LOC421584 antikoerper
- Hintergrund
- Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- Hormone Transport
-