BLK Antikörper (Middle Region)

Produktnummer ABIN630217

Produktdetails anti-BLK Antikörper

Target: BLK (B Lymphoid Tyrosine Kinase (BLK))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BLK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BLK antibody was raised against the middle region of BLK

Aufreinigung: Purified

Immunogen: BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BLK Blocking Peptide, catalog no. 33R-1621, is also available for use as a blocking control in assays to test for specificity of this BLK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BLK

Target: BLK (B Lymphoid Tyrosine Kinase (BLK))

Andere Bezeichnung: BLK (BLK Produkte)

Synonyme: bltk antikoerper, si:dkey-33i22.2 antikoerper, zgc:136231 antikoerper, MODY11 antikoerper, BLK proto-oncogene, Src family tyrosine kinase antikoerper, B lymphoid kinase antikoerper, blk antikoerper, BLK antikoerper, Blk antikoerper

Hintergrund: BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling