DVL1 Antikörper
-
- Target Alle DVL1 Antikörper anzeigen
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DVL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
- Top Product
- Discover our top product DVL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DVL1 Blocking Peptide, catalog no. 33R-5088, is also available for use as a blocking control in assays to test for specificity of this DVL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
- Andere Bezeichnung
- DVL1 (DVL1 Produkte)
- Synonyme
- DVL antikoerper, DVL1L1 antikoerper, DVL1P1 antikoerper, Dvl antikoerper, mKIAA4029 antikoerper, dvl-1 antikoerper, DSH antikoerper, DVL-1 antikoerper, dvl1 antikoerper, dvl2l antikoerper, Xdsh antikoerper, dsh1 antikoerper, dishevelled segment polarity protein 1 antikoerper, dishevelled, dsh homolog 1 (Drosophila) antikoerper, microRNA 6808 antikoerper, dishevelled segment polarity protein 1b antikoerper, dishevelled segment polarity protein 1 L homeolog antikoerper, DVL1 antikoerper, Dvl1 antikoerper, MIR6808 antikoerper, dvl1b antikoerper, dvl1.L antikoerper
- Hintergrund
- DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Synaptic Membrane, Skeletal Muscle Fiber Development
-