GZMH Antikörper
-
- Target Alle GZMH Antikörper anzeigen
- GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GZMH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
- Top Product
- Discover our top product GZMH Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))
- Andere Bezeichnung
- Granzyme H (GZMH Produkte)
- Synonyme
- GZMH antikoerper, CCP-X antikoerper, CGL-2 antikoerper, CSP-C antikoerper, CTLA1 antikoerper, CTSGL2 antikoerper, granzyme H antikoerper, LOC617313 antikoerper, GZMH antikoerper
- Hintergrund
- This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.
- Molekulargewicht
- 27 kDa (MW of target protein)
-