GZMH Antikörper

Produktnummer ABIN630169

Produktdetails anti-GZMH Antikörper

Target: GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GZMH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GZMH

Target: GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))

Andere Bezeichnung: Granzyme H (GZMH Produkte)

Synonyme: GZMH antikoerper, CCP-X antikoerper, CGL-2 antikoerper, CSP-C antikoerper, CTLA1 antikoerper, CTSGL2 antikoerper, granzyme H antikoerper, LOC617313 antikoerper, GZMH antikoerper

Hintergrund: This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.

Molekulargewicht: 27 kDa (MW of target protein)