Chromogranin A Antikörper

Produktnummer ABIN630138

Produktdetails anti-Chromogranin A Antikörper

Target: Chromogranin A (CHGA)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Chromogranin A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Chromogranin A Blocking Peptide, catalog no. 33R-7425, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Chromogranin A

Target: Chromogranin A (CHGA)

Andere Bezeichnung: Chromogranin A (CHGA Produkte)

Synonyme: CGA antikoerper, CG-ALPHA antikoerper, FSHA antikoerper, GPHA1 antikoerper, GPHa antikoerper, HCG antikoerper, LHA antikoerper, TSHA antikoerper, ChrA antikoerper, fj05f09 antikoerper, si:dkey-177p2.2 antikoerper, wu:fj05f09 antikoerper, zgc:101749 antikoerper, zgc:56075 antikoerper, CHGA antikoerper, cgA antikoerper, chga antikoerper, chromogranin A antikoerper, glycoprotein hormones, alpha polypeptide antikoerper, uncharacterized CHGA antikoerper, chromogranin A S homeolog antikoerper, CHGA antikoerper, CGA antikoerper, Chga antikoerper, chga antikoerper, chga.S antikoerper

Hintergrund: CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling