WNT5B Antikörper (C-Term)

Produktnummer ABIN630136

Produktdetails anti-WNT5B Antikörper

Target: WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT5 B antibody was raised against the C terminal of WNT5

Aufreinigung: Purified

Immunogen: WNT5 B antibody was raised using the C terminal of WNT5 corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT5B Blocking Peptide, catalog no. 33R-3537, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT5B

Target: WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))

Andere Bezeichnung: WNT5B (WNT5B Produkte)

Synonyme: wnt-5b antikoerper, xwnt5b antikoerper, WNT5B antikoerper, AW545702 antikoerper, Wnt-5b antikoerper, xwnt-5c antikoerper, CHUNP6928 antikoerper, id:ibd5111 antikoerper, ppt antikoerper, wnt-5 antikoerper, wnt5 antikoerper, wnt[b] antikoerper, wu:fk85g06 antikoerper, Wnt family member 5B antikoerper, wingless-type MMTV integration site family, member 5B antikoerper, Wnt family member 5B S homeolog antikoerper, wingless-type MMTV integration site family, member 5b antikoerper, wnt5b antikoerper, WNT5B antikoerper, Wnt5b antikoerper, wnt5b.S antikoerper

Hintergrund: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: WNT Signalweg, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation