MMP7 Antikörper

Produktnummer ABIN630130

Produktdetails anti-MMP7 Antikörper

Target: MMP7 (Matrix Metallopeptidase 7 (Matrilysin, Uterine) (MMP7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: MMP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP7 Blocking Peptide, catalog no. 33R-1053, is also available for use as a blocking control in assays to test for specificity of this MMP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP7

Target: MMP7 (Matrix Metallopeptidase 7 (Matrilysin, Uterine) (MMP7))

Andere Bezeichnung: MMP7 (MMP7 Produkte)

Synonyme: MAT antikoerper, MPMM antikoerper, MMP-7 antikoerper, MPSL1 antikoerper, PUMP-1 antikoerper, matrilysin antikoerper, LOC727698 antikoerper, MMP7 antikoerper, Matrilysin antikoerper, matrix metallopeptidase 7 antikoerper, MMP7 antikoerper, Mmp7 antikoerper

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP7 degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response