CHRNA7 Antikörper (Middle Region)

Produktnummer ABIN630113

Produktdetails anti-CHRNA7 Antikörper

Target: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHRNA7 antibody was raised against the middle region of CHRNA7

Aufreinigung: Purified

Immunogen: CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNA7 Blocking Peptide, catalog no. 33R-9739, is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNA7

Target: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Andere Bezeichnung: CHRNA7 (CHRNA7 Produkte)

Synonyme: CHRNA7-2 antikoerper, NACHRA7 antikoerper, dZ70B1.1 antikoerper, Acra7 antikoerper, alpha7 antikoerper, BTX antikoerper, NARAD antikoerper, nAChRa7 antikoerper, CHRNA7 antikoerper, cholinergic receptor nicotinic alpha 7 subunit antikoerper, neuronal acetylcholine receptor subunit alpha-7 antikoerper, cholinergic receptor, nicotinic, alpha 7 (neuronal) antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 7 antikoerper, cholinergic receptor, nicotinic, alpha 7 antikoerper, CHRNA7 antikoerper, LOC100374356 antikoerper, chrna7 antikoerper, Chrna7 antikoerper, LOC100060521 antikoerper

Hintergrund: The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane