CLCN6 Antikörper (C-Term)

Produktnummer ABIN630094

Produktdetails anti-CLCN6 Antikörper

Target: CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCN6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLCN6 antibody was raised against the C terminal of CLCN6

Aufreinigung: Purified

Immunogen: CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLCN6 Blocking Peptide, catalog no. 33R-7295, is also available for use as a blocking control in assays to test for specificity of this CLCN6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLCN6

Target: CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))

Andere Bezeichnung: CLCN6 (CLCN6 Produkte)

Synonyme: CLC-6 antikoerper, AI850629 antikoerper, CLCN6 antikoerper, wu:fb95f01 antikoerper, DKFZp469B244 antikoerper, DKFZp469L0417 antikoerper, chloride voltage-gated channel 6 antikoerper, chloride channel, voltage-sensitive 6 antikoerper, chloride channel 6 antikoerper, chloride transport protein 6 antikoerper, CLCN6 antikoerper, Clcn6 antikoerper, clcn6 antikoerper, LOC579870 antikoerper

Hintergrund: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.

Molekulargewicht: 39 kDa (MW of target protein)