CACNB2 Antikörper (Middle Region)

Produktnummer ABIN630074

Produktdetails anti-CACNB2 Antikörper

Target: CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNB2 antibody was raised against the middle region of CACNB2

Aufreinigung: Purified

Immunogen: CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNB2 Blocking Peptide, catalog no. 33R-2242, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNB2

Target: CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))

Andere Bezeichnung: CACNB2 (CACNB2 Produkte)

Synonyme: CACNLB2 antikoerper, CAVB2 antikoerper, MYSB antikoerper, AW060387 antikoerper, CAB2 antikoerper, Cavbeta2 antikoerper, Cchb2 antikoerper, Cacnlb2 antikoerper, Cacnb2 antikoerper, CACNB2 antikoerper, CACNB2.2 antikoerper, cacnb2a antikoerper, im:7141271 antikoerper, si:dkey-32m20.2 antikoerper, calcium voltage-gated channel auxiliary subunit beta 2 antikoerper, calcium channel, voltage-dependent, beta 2 subunit antikoerper, calcium channel, voltage-dependent, beta 2b antikoerper, CACNB2 antikoerper, Cacnb2 antikoerper, cacnb2b antikoerper

Hintergrund: CACNB2 is a member of the ion-channel geneuperfamily. Described as a Lambert-Eaton myasthenic syndrome (LEMS) antigen in humans, this gene is found close to a region that undergoes chromosome rearrangements in small cell lung cancer, which occurs in association with LEMS.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development