CLIC4 Antikörper (N-Term)

Produktnummer ABIN630071

Produktdetails anti-CLIC4 Antikörper

Target: CLIC4 (Chloride Intracellular Channel 4 (CLIC4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLIC4 antibody was raised against the N terminal of CLIC4

Aufreinigung: Purified

Immunogen: CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC4 Blocking Peptide, catalog no. 33R-5440, is also available for use as a blocking control in assays to test for specificity of this CLIC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC4

Target: CLIC4 (Chloride Intracellular Channel 4 (CLIC4))

Andere Bezeichnung: CLIC4 (CLIC4 Produkte)

Synonyme: CLIC4L antikoerper, H1 antikoerper, MTCLIC antikoerper, huH1 antikoerper, p64H1 antikoerper, cb142 antikoerper, wu:fb33c05 antikoerper, wu:fc30h10 antikoerper, clic4 antikoerper, MGC89006 antikoerper, CLIC4 antikoerper, DKFZp459A0325 antikoerper, D0Jmb3 antikoerper, TU-74 antikoerper, mc3s5 antikoerper, mtCLIC antikoerper, xclic4 antikoerper, chloride intracellular channel 4 antikoerper, chloride intracellular channel 4 (mitochondrial) antikoerper, chloride intracellular channel 4 S homeolog antikoerper, CLIC4 antikoerper, Clic4 antikoerper, clic4 antikoerper, clic4.S antikoerper

Hintergrund: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIon Channel4) protein, encoded by the CLIon Channel4 gene, is a member of the p64 family, the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).

Molekulargewicht: 28 kDa (MW of target protein)