KCNN2 Antikörper (C-Term)

Produktnummer ABIN630068

Produktdetails anti-KCNN2 Antikörper

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNN2 antibody was raised against the C terminal of KCNN2

Aufreinigung: Purified

Immunogen: KCNN2 antibody was raised using the C terminal of KCNN2 corresponding to a region with amino acids IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNN2 Blocking Peptide, catalog no. 33R-3914, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNN2

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Andere Bezeichnung: KCNN2 (KCNN2 Produkte)

Synonyme: KCNN2 antikoerper, SK2 antikoerper, KCa2.2 antikoerper, SKCA2 antikoerper, SKCa 2 antikoerper, hSK2 antikoerper, fri antikoerper, potassium calcium-activated channel subfamily N member 2 antikoerper, potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 antikoerper, KCNN2 antikoerper, Kcnn2 antikoerper

Hintergrund: Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.

Molekulargewicht: 64 kDa (MW of target protein)