SSB Antikörper
-
- Target Alle SSB Antikörper anzeigen
- SSB (Sjogren Syndrome Antigen B (SSB))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SSB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids PGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEED
- Top Product
- Discover our top product SSB Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SSB Blocking Peptide, catalog no. 33R-7124, is also available for use as a blocking control in assays to test for specificity of this SSB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSB (Sjogren Syndrome Antigen B (SSB))
- Andere Bezeichnung
- SSB (SSB Produkte)
- Synonyme
- LARP3 antikoerper, La antikoerper, lab1 antikoerper, larp3 antikoerper, ssb antikoerper, Mt-SSB antikoerper, MtSSB antikoerper, Ssbp1 antikoerper, SS-B antikoerper, laa-a antikoerper, ssb-a antikoerper, ssb-b antikoerper, wu:fb17f11 antikoerper, zgc:55588 antikoerper, Sjogren syndrome antigen B antikoerper, Sjogren syndrome antigen B L homeolog antikoerper, single stranded DNA binding protein 1 antikoerper, Sjogren syndrome antigen B S homeolog antikoerper, Sjogren syndrome antigen B (autoantigen La) antikoerper, SSB antikoerper, ssb.L antikoerper, SSBP1 antikoerper, Ssb antikoerper, ssb.S antikoerper, ssb antikoerper
- Hintergrund
- SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.
- Molekulargewicht
- 47 kDa (MW of target protein)
-