TRA2B Antikörper
-
- Target Alle TRA2B Antikörper anzeigen
- TRA2B (Transformer 2 beta Homolog (TRA2B))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRA2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
- Top Product
- Discover our top product TRA2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS10 Blocking Peptide, catalog no. 33R-3636, is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRA2B (Transformer 2 beta Homolog (TRA2B))
- Andere Bezeichnung
- SFRS10 (TRA2B Produkte)
- Synonyme
- sfrs10 antikoerper, SFRS10 antikoerper, Htra2-beta antikoerper, SRFS10 antikoerper, TRA2-BETA antikoerper, TRAN2B antikoerper, 5730405G21Rik antikoerper, D16Ertd266e antikoerper, SIG-41 antikoerper, Sfrs10 antikoerper, Silg41 antikoerper, TRA2beta antikoerper, Srsf10 antikoerper, zgc:56612 antikoerper, transformer 2 beta homolog (Drosophila) antikoerper, transformer 2 beta homolog L homeolog antikoerper, transformer 2 beta homolog antikoerper, tra2b antikoerper, tra2b.L antikoerper, TRA2B antikoerper, Tra2b antikoerper
- Hintergrund
- SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
- Molekulargewicht
- 32 kDa (MW of target protein)
-