EIF4B Antikörper (C-Term)
-
- Target Alle EIF4B Antikörper anzeigen
- EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF4B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EIF4 B antibody was raised against the C terminal of EIF4
- Aufreinigung
- Purified
- Immunogen
- EIF4 B antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ
- Top Product
- Discover our top product EIF4B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF4B Blocking Peptide, catalog no. 33R-6824, is also available for use as a blocking control in assays to test for specificity of this EIF4B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))
- Andere Bezeichnung
- EIF4B (EIF4B Produkte)
- Synonyme
- EIF-4B antikoerper, PRO1843 antikoerper, CG10837 antikoerper, Dm-eIF4B antikoerper, Dmel\\CG10837 antikoerper, Eif4B antikoerper, eIF-4B-L antikoerper, eIF-4B-S antikoerper, eIF-4b antikoerper, eIF4B antikoerper, eIF4B-L antikoerper, eIF4B-S antikoerper, eIf4b antikoerper, 2310046H11Rik antikoerper, AL024095 antikoerper, C85189 antikoerper, Eif4a2 antikoerper, eif4b antikoerper, fb15c09 antikoerper, wu:fb15c09 antikoerper, zgc:101532 antikoerper, MGC89384 antikoerper, eukaryotic translation initiation factor 4B antikoerper, eukaryotic initiation factor 4B antikoerper, Eukaryotic initiation factor 4B antikoerper, eukaryotic translation initiation factor 4Bb antikoerper, eukaryotic translation initiation factor 4Ba antikoerper, eukaryotic translation initiation factor 4B S homeolog antikoerper, EIF4B antikoerper, Eif4B antikoerper, eIF-4B antikoerper, Eif4b antikoerper, eif4bb antikoerper, eif4b antikoerper, eif4ba antikoerper, eif4b.S antikoerper, LOC100284982 antikoerper, LOC100380867 antikoerper
- Hintergrund
- IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.
- Molekulargewicht
- 67 kDa (MW of target protein)
-