DDX31 Antikörper

Produktnummer ABIN629959

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DDX31 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für DDX31 Antikörper (ABIN629959)

Target: DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX31 Antikörper

Aufreinigung: Purified

Immunogen: DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX31 Blocking Peptide, (ABIN5613159), is also available for use as a blocking control in assays to test for specificity of this DDX31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX31

Target: DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))

Andere Bezeichnung: DDX31

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX31 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants.

Molekulargewicht: 64 kDa (MW of target protein)