DDX31 Antikörper
-
- Target Alle DDX31 Antikörper anzeigen
- DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX31 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS
- Top Product
- Discover our top product DDX31 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX31 Blocking Peptide, catalog no. 33R-7480, is also available for use as a blocking control in assays to test for specificity of this DDX31 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX31 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))
- Andere Bezeichnung
- DDX31 (DDX31 Produkte)
- Synonyme
- fc62b08 antikoerper, si:ch211-89p1.3 antikoerper, wu:fc62b08 antikoerper, DDX31 antikoerper, PPP1R25 antikoerper, 5830444G11Rik antikoerper, Gm997 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 antikoerper, DEAD-box helicase 31 antikoerper, DEAD-box helicase 31 L homeolog antikoerper, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31 antikoerper, ddx31 antikoerper, DDX31 antikoerper, ddx31.L antikoerper, Ddx31 antikoerper
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX31 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants.
- Molekulargewicht
- 64 kDa (MW of target protein)
-