MAGEA1 Antikörper

Produktnummer ABIN629810

Produktdetails anti-MAGEA1 Antikörper

Target: MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEA1 Blocking Peptide, catalog no. 33R-6107, is also available for use as a blocking control in assays to test for specificity of this MAGEA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEA1

Target: MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))

Andere Bezeichnung: MAGEA1 (MAGEA1 Produkte)

Synonyme: CT1.1 antikoerper, MAGE1 antikoerper, Mage-a1 antikoerper, MAGE family member A1 antikoerper, melanoma antigen, family A, 1 antikoerper, MAGEA1 antikoerper, Magea1 antikoerper

Hintergrund: The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Molekulargewicht: 34 kDa (MW of target protein)