XRCC5 Antikörper
-
- Target Alle XRCC5 Antikörper anzeigen
- XRCC5 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-Strand-Break Rejoining) (XRCC5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XRCC5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- XRCC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
- Top Product
- Discover our top product XRCC5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XRCC5 Blocking Peptide, catalog no. 33R-3345, is also available for use as a blocking control in assays to test for specificity of this XRCC5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRCC5 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-Strand-Break Rejoining) (XRCC5))
- Andere Bezeichnung
- XRCC5 (XRCC5 Produkte)
- Synonyme
- AI314015 antikoerper, Ku80 antikoerper, Ku86 antikoerper, Kup80 antikoerper, KARP-1 antikoerper, KARP1 antikoerper, KU80 antikoerper, KUB2 antikoerper, NFIV antikoerper, xrcc5-a antikoerper, XRCC5 antikoerper, X-ray repair cross complementing 5 antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 5 antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 5 L homeolog antikoerper, XRCC5 antikoerper, Xrcc5 antikoerper, xrcc5.L antikoerper
- Hintergrund
- XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
- Molekulargewicht
- 83 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-