TNNT3 Antikörper
-
- Target Alle TNNT3 Antikörper anzeigen
- TNNT3 (Fast Skeletal Troponin T (TNNT3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNNT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
- Top Product
- Discover our top product TNNT3 Primärantikörper
-
anti-Fast Skeletal Troponin T (TNNT3) (AA 161-258) antibody
TNNT3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1F12 unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (C-Term) antibodyTNNT3 Reaktivität: Human, Maus WB, ELISA, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Fast Skeletal Troponin T (TNNT3) antibodyTNNT3 Reaktivität: Human, Huhn, Wachtel WB, ELISA, IHC, IHC (p), IHC (fro) Wirt: Maus Monoclonal T1-61 unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (AA 161-258) antibodyTNNT3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1H4 unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (AA 217-245), (C-Term) antibodyTNNT3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB36783 unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (AA 161-258) antibodyTNNT3 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (AA 1-250) antibodyTNNT3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (AA 147-256) antibodyTNNT3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (AA 31-80) antibodyTNNT3 Reaktivität: Human, Maus, Ratte, Kaninchen, Meerschweinchen, Huhn, Rind (Kuh), Pferd, Hund, Ziege, Zebrafisch (Danio rerio), Affe, Schwein, Fledermaus, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Fast Skeletal Troponin T (TNNT3) (C-Term) antibody (Biotin)Verified TNNT3 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Ziege Polyclonal Biotin
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Troponin T Type 3 Blocking Peptide, catalog no. 33R-7331, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNNT3 (Fast Skeletal Troponin T (TNNT3))
- Andere Bezeichnung
- Troponin T Type 3 (TNNT3 Produkte)
- Synonyme
- fTnT antikoerper, tnnt3a antikoerper, TNTF antikoerper, TnTf antikoerper, Tnt antikoerper, Tnnt3 antikoerper, troponin T3, fast skeletal type antikoerper, troponin T3, skeletal, fast antikoerper, troponin T3, fast skeletal type S homeolog antikoerper, troponin T type 3 (skeletal, fast) antikoerper, troponin T1, slow skeletal type antikoerper, TNNT3 antikoerper, Tnnt3 antikoerper, tnnt3.S antikoerper, TNNT1 antikoerper
- Hintergrund
- Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
- Molekulargewicht
- 30 kDa (MW of target protein)
-
