PPFIBP1 Antikörper

Produktnummer ABIN629802

Produktdetails anti-PPFIBP1 Antikörper

Target: PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPFIBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPFIBP1 Blocking Peptide, catalog no. 33R-7081, is also available for use as a blocking control in assays to test for specificity of this PPFIBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPFIBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPFIBP1

Target: PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))

Andere Bezeichnung: PPFIBP1 (PPFIBP1 Produkte)

Synonyme: liprin-beta-1 antikoerper, L2 antikoerper, SGT2 antikoerper, hSGT2 antikoerper, hSgt2p antikoerper, 4632409B19Rik antikoerper, AW214454 antikoerper, AW261454 antikoerper, PPFIA binding protein 1 antikoerper, PTPRF interacting protein, binding protein 1 (liprin beta 1) antikoerper, PTPRF interacting protein, binding protein 1 (liprin beta 1) S homeolog antikoerper, Ppfibp1 antikoerper, ppfibp1 antikoerper, ppfibp1.S antikoerper, PPFIBP1 antikoerper

Hintergrund: PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.

Molekulargewicht: 19 kDa (MW of target protein)