FAH Antikörper

Produktnummer ABIN629635

Produktdetails anti-FAH Antikörper

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAH Blocking Peptide, catalog no. 33R-1054, is also available for use as a blocking control in assays to test for specificity of this FAH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAH

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Andere Bezeichnung: FAH (FAH Produkte)

Synonyme: CG14993 antikoerper, Dmel\\CG14993 antikoerper, dfaa antikoerper, l(3)64Al antikoerper, l(3)SH11 antikoerper, PSPTO3550 antikoerper, fb59b12 antikoerper, wu:fb59b12 antikoerper, zgc:55316 antikoerper, FAA antikoerper, Fumarylacetoacetase antikoerper, FumarylAcetoacetate Hydrolase antikoerper, fumarylacetoacetase antikoerper, fumarylacetoacetate hydrolase antikoerper, fumarylacetoacetate hydrolase (fumarylacetoacetase) antikoerper, fumarylacetoacetate hydrolase (fumarylacetoacetase) L homeolog antikoerper, Faa antikoerper, fah-1 antikoerper, fahA antikoerper, hmgB antikoerper, Ndas_1870 antikoerper, Lbys_3503 antikoerper, Riean_0663 antikoerper, Ftrac_0820 antikoerper, Celal_3675 antikoerper, Celly_2655 antikoerper, Weevi_0208 antikoerper, Fluta_2435 antikoerper, Halhy_2019 antikoerper, Lacal_2931 antikoerper, FsymDg_1892 antikoerper, Fah antikoerper, fah antikoerper, fah.L antikoerper, FAH antikoerper

Hintergrund: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Molekulargewicht: 46 kDa (MW of target protein)