XRCC6 Antikörper (N-Term)
-
- Target Alle XRCC6 Antikörper anzeigen
- XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XRCC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- G22 P1 antibody was raised against the N terminal Of G22 1
- Aufreinigung
- Purified
- Immunogen
- G22 P1 antibody was raised using the N terminal Of G22 1 corresponding to a region with amino acids MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE
- Top Product
- Discover our top product XRCC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
G22P1 Blocking Peptide, catalog no. 33R-6438, is also available for use as a blocking control in assays to test for specificity of this G22P1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))
- Andere Bezeichnung
- G22P1 (XRCC6 Produkte)
- Synonyme
- CTC75 antikoerper, CTCBF antikoerper, G22P1 antikoerper, KU70 antikoerper, ML8 antikoerper, TLAA antikoerper, 70kDa antikoerper, G22p1 antikoerper, Ku70 antikoerper, Kup70 antikoerper, X-ray repair cross complementing 6 antikoerper, ATP-dependent DNA helicase II, 70 kDa subunit antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 6 antikoerper, XRCC6 antikoerper, Bm1_41430 antikoerper, xrcc6.L antikoerper, Xrcc6 antikoerper
- Hintergrund
- The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-