MBD2 Antikörper (Middle Region)

Produktnummer ABIN629604

Produktdetails anti-MBD2 Antikörper

Target: MBD2 (Methyl-CpG Binding Domain Protein 2 (MBD2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MBD2 antibody was raised against the middle region of MBD2

Aufreinigung: Purified

Immunogen: MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBD2 Blocking Peptide, catalog no. 33R-1873, is also available for use as a blocking control in assays to test for specificity of this MBD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBD2

Target: MBD2 (Methyl-CpG Binding Domain Protein 2 (MBD2))

Andere Bezeichnung: MBD2 (MBD2 Produkte)

Synonyme: MBD2 antikoerper, DMTase antikoerper, NY-CO-41 antikoerper, MBD2a antikoerper, wu:fa97f06 antikoerper, zgc:111862 antikoerper, methyl-CpG binding domain protein 2 antikoerper, methyl-CpG binding domain protein 2 S homeolog antikoerper, MBD2 antikoerper, Mbd2 antikoerper, mbd2 antikoerper, mbd2.S antikoerper

Hintergrund: MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal. It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Chromatin Binding