KDM2A Antikörper

Produktnummer ABIN5708449

Produktdetails anti-KDM2A Antikörper

Target: KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KDM2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Kreuzreaktivität (Details): Expected species reactivity: Rat

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR from the human protein were used as the immunogen for the FBXL11 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FBXL11 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the FBXL11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KDM2A

Target: KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))

Andere Bezeichnung: KDM2A / FBXL11 (KDM2A Produkte)

Synonyme: FBXL11 antikoerper, JHDM1A antikoerper, 100043628 antikoerper, 5530401A10Rik antikoerper, AA589516 antikoerper, AW536790 antikoerper, Cxxc8 antikoerper, Fbl11 antikoerper, Fbl7 antikoerper, Fbxl11 antikoerper, Gm4560 antikoerper, Jhdm1 antikoerper, Jhdm1a antikoerper, lalina antikoerper, KDM2A antikoerper, CXXC8 antikoerper, FBL11 antikoerper, FBL7 antikoerper, LILINA antikoerper, fb76b11 antikoerper, wu:fb76b11 antikoerper, wu:fj11c04 antikoerper, zgc:158441 antikoerper, zgc:158606 antikoerper, lysine demethylase 2A antikoerper, lysine (K)-specific demethylase 2A antikoerper, lysine (K)-specific demethylase 2Aa antikoerper, KDM2A antikoerper, Kdm2a antikoerper, kdm2aa antikoerper

Hintergrund: Lysine-specific demethylase 2A (KDM2A) also known as F-box and leucine-rich repeat protein 11 (FBXL11) is an enzyme that in humans is encoded by the KDM2A gene. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.

UniProt: Q9Y2K7

Pathways: Warburg Effekt