FZD4 Antikörper

Produktnummer ABIN5708436

Produktdetails anti-FZD4 Antikörper

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FZD4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the FZD4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Andere Bezeichnung: Frizzled 4 / FZD4 (FZD4 Produkte)

Synonyme: CG4626 antikoerper, DFz4 antikoerper, Dfz4 antikoerper, Dm Fz4 antikoerper, Dmel\\CG4626 antikoerper, Fz4 antikoerper, anon-WO0170980.10 antikoerper, anon-WO0170980.11 antikoerper, fz1 antikoerper, zg01 antikoerper, CD344 antikoerper, EVR1 antikoerper, FEVR antikoerper, FZD4S antikoerper, Fz-4 antikoerper, FzE4 antikoerper, GPCR antikoerper, hFz4 antikoerper, frizzled4 antikoerper, fz4 antikoerper, FZ-4 antikoerper, frizzled 4 antikoerper, frizzled class receptor 4 antikoerper, frizzled-4 antikoerper, frizzled class receptor 4 S homeolog antikoerper, fz4 antikoerper, fzd4 antikoerper, Tsp_10376 antikoerper, FZD4 antikoerper, Fzd4 antikoerper, fzd4.S antikoerper

Hintergrund: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

UniProt: Q9ULV1

Pathways: WNT Signalweg, Hormone Transport, Sensory Perception of Sound