ERBB4 Antikörper

Produktnummer ABIN5708421

Produktdetails anti-ERBB4 Antikörper

Target: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERBB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ERBB4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ERBB4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ERBB4

Target: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Andere Bezeichnung: ERBB4 / HER4 (ERBB4 Produkte)

Synonyme: erbb4 antikoerper, si:ch211-227n20.1 antikoerper, Her4 antikoerper, c-erbB-4 antikoerper, HER4 antikoerper, p180erbB4 antikoerper, erb-b2 receptor tyrosine kinase 4 antikoerper, erb-b2 receptor tyrosine kinase 4a antikoerper, v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) antikoerper, erb-b2 receptor tyrosine kinase 4 L homeolog antikoerper, receptor tyrosine-protein kinase ErbB-4 antikoerper, ERBB4 antikoerper, erbb4a antikoerper, erbb4 antikoerper, erbb4.L antikoerper, Tsp_13582 antikoerper, Erbb4 antikoerper

Hintergrund: ERBB4 (V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.

UniProt: Q15303

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung