FLT1 Antikörper
-
- Target Alle FLT1 Antikörper anzeigen
- FLT1 (Fms-Related tyrosine Kinase 1 (VEGFR1) (FLT1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FLT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Sequenz
- DPELSLKGTQ HIMQAGQTLH LQCRGEAAHK WSLPEMVSKE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for VEGF Receptor 1 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human VEGF Receptor 1 (DPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE).
- Top Product
- Discover our top product FLT1 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
: "Role of transient receptor potential ion channels and evoked levels of neuropeptides in a formaldehyde-induced model of asthma in BALB/c mice." in: PLoS ONE, Vol. 8, Issue 5, pp. e62827, (2013) (PubMed).
: "
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
-
- Target
- FLT1 (Fms-Related tyrosine Kinase 1 (VEGFR1) (FLT1))
- Andere Bezeichnung
- FLT1 (FLT1 Produkte)
- Synonyme
- FLT antikoerper, FLT-1 antikoerper, VEGFR-1 antikoerper, VEGFR1 antikoerper, FLT1 antikoerper, flt1b antikoerper, sFlt1 antikoerper, AI323757 antikoerper, Flt-1 antikoerper, fms related tyrosine kinase 1 antikoerper, FMS-related tyrosine kinase 1 antikoerper, vascular endothelial growth factor receptor 1 antikoerper, fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) antikoerper, FMS-like tyrosine kinase 1 antikoerper, vascular endothelial growth factor receptor-1 antikoerper, FLT1 antikoerper, Flt1 antikoerper, CpipJ_CPIJ012087 antikoerper, flt1 antikoerper, FLT-1 antikoerper
- Hintergrund
-
Synonyms: Vascular endothelial growth factor receptor 1, VEGFR-1, Fms-like tyrosine kinase 1, FLT-1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, FLT, Vascular permeability factor receptor, FLT1, FLT, FRT, VEGFR1
Tissue Specificity: Detected in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform 2 is strongly expressed in placenta. Isoform 3 is expressed in corneal epithelial cells (at protein level). Isoform 3 is expressed in vascular smooth muscle cells (VSMC).
Background: Vascular endothelial growth factor receptor 1 (FLT1) is a protein that in humans is encoded by the FLT1 gene. Oncogene FLT belongs to the src gene family. It is mapped to 13q12. The deduced 1,338-amino acid protein has a calculated molecular mass of 150.6 kD. It has a 758-amino acid extracellular domain, followed by a 22-amino acid transmembrane region and a 558-amino acid cytoplasmic region containing a cluster of basic amino acids and a tyrosine kinase domain. sFLT-1 was identified in placenta, adult lung, kidney, liver and uterus. Like other members of this family, it shows tyrosine protein kinase activity that is important for the control of cell proliferation and differentiation.
- UniProt
- P17948
- Pathways
- RTK Signalweg, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
-