KLF4 Antikörper

Produktnummer ABIN5693240

Produktdetails anti-KLF4 Antikörper

Target: KLF4 (Kruppel-Like Factor 4 (Gut) (KLF4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marke: Picoband™

Sequenz: EKTLRQAGAP NNRWREELSH MKRLPPVLPG RPYDLA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for KLF4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human KLF4 (EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-KLF4 Antikörper (ABIN5693240)

Ai, Shao, Shi, Yu, Wu, Du, Zhang, Guo: "Maintenance of Self-Renewal and Pluripotency in J1 Mouse Embryonic Stem Cells through Regulating Transcription Factor and MicroRNA Expression Induced by PD0325901." in: Stem cells international, Vol. 2016, pp. 1792573, (2016) (PubMed).

Ai, Shao, Wu, Yu, Du, Shi, Shi, Zhang, Guo: "CHIR99021 enhances Klf4 Expression through β-Catenin Signaling and miR-7a Regulation in J1 Mouse Embryonic Stem Cells." in: PLoS ONE, Vol. 11, Issue 3, pp. e0150936, (2016) (PubMed).

Details zu KLF4

Target: KLF4 (Kruppel-Like Factor 4 (Gut) (KLF4))

Andere Bezeichnung: KLF4 (KLF4 Produkte)

Synonyme: EZF antikoerper, GKLF antikoerper, Gklf antikoerper, Zie antikoerper, KLF4 antikoerper, biklf antikoerper, biklf-A antikoerper, Kruppel like factor 4 antikoerper, Kruppel-like factor 4 (gut) antikoerper, Kruppel-like factor 4 antikoerper, Kruppel-like factor 4 (gut) L homeolog antikoerper, KLF4 antikoerper, Klf4 antikoerper, klf4 antikoerper, klf4.L antikoerper

Hintergrund:

Synonyms: Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4, EZF, GKLF

Background: Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2. KLF4 gene encodes a member of the Kruppel family of transcription factors. This gene plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. It is required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. This gene involved in the differentiation of epithelial cells and may also function in skeletal and kidney development.

UniProt: O43474

Pathways: Peptide Hormone Metabolism, Stem Cell Maintenance