FZD4 Antikörper

Produktnummer ABIN5693200

Produktdetails anti-FZD4 Antikörper

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Marke: Picoband™

Sequenz: QNLGYNVTKM PNLVGHELQT DAELQLTTFT PLIQY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Frizzled 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-FZD4 Antikörper (ABIN5693200)

Bychkov, Kirichenko, Shulepko, Mikhaylova, Kirpichnikov, Lyukmanova: "Mambalgin-2 Inhibits Growth, Migration, and Invasion of Metastatic Melanoma Cells by Targeting the Channels Containing an ASIC1a Subunit Whose Up-Regulation Correlates with Poor Survival Prognosis." in: Biomedicines, Vol. 9, Issue 10, (2021) (PubMed).

Details zu FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Andere Bezeichnung: FZD4 (FZD4 Produkte)

Synonyme: CG4626 antikoerper, DFz4 antikoerper, Dfz4 antikoerper, Dm Fz4 antikoerper, Dmel\\CG4626 antikoerper, Fz4 antikoerper, anon-WO0170980.10 antikoerper, anon-WO0170980.11 antikoerper, fz1 antikoerper, zg01 antikoerper, CD344 antikoerper, EVR1 antikoerper, FEVR antikoerper, FZD4S antikoerper, Fz-4 antikoerper, FzE4 antikoerper, GPCR antikoerper, hFz4 antikoerper, frizzled4 antikoerper, fz4 antikoerper, FZ-4 antikoerper, frizzled 4 antikoerper, frizzled class receptor 4 antikoerper, frizzled-4 antikoerper, frizzled class receptor 4 S homeolog antikoerper, fz4 antikoerper, fzd4 antikoerper, Tsp_10376 antikoerper, FZD4 antikoerper, Fzd4 antikoerper, fzd4.S antikoerper

Hintergrund:

Synonyms: Frizzled-4, Fz-4, hFz4, FzE4, CD344, FZD4

Tissue Specificity: Almost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and liver.

Background: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Pathways: WNT Signalweg, Hormone Transport, Sensory Perception of Sound