NR4A3 Antikörper

Produktnummer ABIN5692903

Produktdetails anti-NR4A3 Antikörper

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR4A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: HDANTLYIFA PSPQSRDLWV KKLKEEIKNN NNIMIKYHPK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tec detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu NR4A3

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Andere Bezeichnung: TEC (NR4A3 Produkte)

Synonyme: CHN antikoerper, CSMF antikoerper, MINOR antikoerper, NOR1 antikoerper, TEC antikoerper, AI573420 antikoerper, NOR-1 antikoerper, Nor1 antikoerper, NOR-2 antikoerper, NR4A3 antikoerper, Nr4a3 antikoerper, nuclear receptor subfamily 4 group A member 3 antikoerper, nuclear receptor subfamily 4, group A, member 3 antikoerper, NR4A3 antikoerper, Nr4a3 antikoerper, nr4a3 antikoerper

Hintergrund:

Synonyms: Tyrosine-protein kinase Tec, TEC, PSCTK4

Tissue Specificity: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.

Background: TEC (TEC Protein Tyrosine Kinase) is an enzyme that in humans is encoded by the TEC gene. The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. By fluorescence in situ hybridization, Sato et al. (1994) mapped the gene to 4p12, the same location reported for TXK. Mouse Tec is a non-receptor type protein-tyrosine kinase that is highly expressed in many hematopoietic cell lines. Hantschel et al. (2007) identified TEC kinase and BTK kinase as major binders of the tyrosine kinase inhibitor dasatinib, which is used for treatment of BCR/ABL-positive CML.

UniProt: P42680

Pathways: Fc-epsilon Rezeptor Signalübertragung, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway