KPNA2 Antikörper (AA 2-46)

Produktnummer ABIN5647802

Produktdetails anti-KPNA2 Antikörper

Target: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Bindungsspezifität: AA 2-46

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 2-46 (STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ) were used as the immunogen for the KPNA2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the KPNA2 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the KPNA2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KPNA2

Target: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Andere Bezeichnung: KPNA2 (KPNA2 Produkte)

Synonyme: IPOA1 antikoerper, QIP2 antikoerper, RCH1 antikoerper, SRP1alpha antikoerper, ima2 antikoerper, importin antikoerper, 2410044B12Rik antikoerper, PTAC58 antikoerper, Rch1 antikoerper, ipoa1 antikoerper, kpna2 antikoerper, qip2 antikoerper, rch1 antikoerper, srp1alpha antikoerper, hm:zeh0389 antikoerper, hm:zeh0389r antikoerper, zgc:113902 antikoerper, zgc:86945 antikoerper, karyopherin subunit alpha 2 antikoerper, importin subunit alpha-2 antikoerper, Importin subunit alpha-2 antikoerper, karyopherin (importin) alpha 2 antikoerper, karyopherin alpha-2 subunit like L homeolog antikoerper, karyopherin alpha 2 (RAG cohort 1, importin alpha 1) antikoerper, KPNA2 antikoerper, EDI_246290 antikoerper, EDI_335040 antikoerper, ima2 antikoerper, Kpna2 antikoerper, kpna2.L antikoerper, kpna2 antikoerper

Hintergrund: Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination.

UniProt: P52292

Pathways: M Phase, Protein targeting to Nucleus