ABCC1 Antikörper (AA 1493-1528)

Produktnummer ABIN5647441

Produktdetails anti-ABCC1 Antikörper

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Bindungsspezifität: AA 1493-1528

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 1493-1528 (DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA) from the human protein were used as the immunogen for the ABCC1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ABCC1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ABCC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Andere Bezeichnung: MRP1 / ABCC1 (ABCC1 Produkte)

Synonyme: ABC29 antikoerper, ABCC antikoerper, GS-X antikoerper, MRP antikoerper, MRP1 antikoerper, Abcc1a antikoerper, Abcc1b antikoerper, Mdrap antikoerper, Mrp1 antikoerper, Avcc1a antikoerper, Mrp antikoerper, ABCC13 antikoerper, ATP binding cassette subfamily C member 1 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 1 antikoerper, multidrug resistance-associated protein 1 antikoerper, ABCC1 antikoerper, Abcc1 antikoerper, LOC100152428 antikoerper, LOC100346553 antikoerper

Hintergrund: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

UniProt: P33527

Pathways: SARS-CoV-2 Protein Interaktom