HTRA1 Antikörper

Produktnummer ABIN5647348

Produktdetails anti-HTRA1 Antikörper

Target: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HTRA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD were used as the immunogen for the HTRA1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HTRA1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HTRA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HTRA1

Target: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Andere Bezeichnung: HTRA1 (HTRA1 Produkte)

Synonyme: htra1 antikoerper, zgc:92029 antikoerper, zgc:172061 antikoerper, l56 antikoerper, htra antikoerper, Xhtra1 antikoerper, prss11 antikoerper, MGC145723 antikoerper, ARMD7 antikoerper, CARASIL antikoerper, HtrA antikoerper, L56 antikoerper, ORF480 antikoerper, PRSS11 antikoerper, AI429470 antikoerper, HTRA antikoerper, Prss11 antikoerper, RSPP11 antikoerper, HTRA1 antikoerper, HtrA serine peptidase 1a antikoerper, HtrA serine peptidase 1 antikoerper, HtrA serine peptidase 1b antikoerper, Serine protease HTRA1 antikoerper, HtrA serine peptidase 1 S homeolog antikoerper, htra1a antikoerper, HTRA1 antikoerper, htra1b antikoerper, htra1 antikoerper, Htra1 antikoerper, htra1.S antikoerper

Hintergrund: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.

UniProt: Q92743

Pathways: Growth Factor Binding