AGO2 Antikörper

Produktnummer ABIN5646978

Produktdetails anti-AGO2 Antikörper

Target: AGO2 (Argonaute 2 (AGO2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Prior to reconstitution, store at 4°C. After reconstitution, the AGO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu AGO2

Target: AGO2 (Argonaute 2 (AGO2))

Andere Bezeichnung: AGO2 / Argonaute 2 (AGO2 Produkte)

Synonyme: EIF2C2 antikoerper, T19E23.7 antikoerper, T19E23_7 antikoerper, argonaute 2 antikoerper, Q10 antikoerper, Eif2c2 antikoerper, Argonaute2 antikoerper, eif2c1 antikoerper, eif2c2 antikoerper, 1110029L17Rik antikoerper, 2310051F07Rik antikoerper, AI225898 antikoerper, AL022874 antikoerper, AW546247 antikoerper, ENSMUSG00000072493 antikoerper, Gerp95 antikoerper, Gm10365 antikoerper, mKIAA4215 antikoerper, AGO2 antikoerper, AG02 antikoerper, AGO 2 antikoerper, Ago-2 antikoerper, Ago2 antikoerper, CG13452 antikoerper, CG7439 antikoerper, Dm Ago2 antikoerper, Dmel\\CG7439 antikoerper, ago antikoerper, ago-2 antikoerper, ago2 antikoerper, dAGO2 antikoerper, dAgo2 antikoerper, eIF2C2 antikoerper, argonaute 2, RISC catalytic component antikoerper, Argonaute family protein antikoerper, argonaute 2, RISC catalytic component L homeolog antikoerper, argonaute RISC catalytic subunit 2 antikoerper, argonaute RISC catalytic component 2 antikoerper, Argonaute 2 antikoerper, AGO2 antikoerper, Ago2 antikoerper, ago2.L antikoerper, ago2 antikoerper

Hintergrund: Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9UKV8

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Ribonucleoprotein Complex Subunit Organization