AGO1 Antikörper (AA 376-409)

Produktnummer ABIN5646975

Produktdetails anti-AGO1 Antikörper

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Bindungsspezifität: AA 376-409

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AGO1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the AGO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu AGO1

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Andere Bezeichnung: AGO1 / Argonaute 1 (EIF2C1 Produkte)

Synonyme: Ago antikoerper, Ago-1 antikoerper, Ago1 antikoerper, CG6671 antikoerper, Dm Ago1 antikoerper, Dmel\\CG6671 antikoerper, MRE20 antikoerper, ago1 antikoerper, ago1-1 antikoerper, anon-WO0257455.29 antikoerper, dAGO1 antikoerper, dAgo1 antikoerper, l(2)04845 antikoerper, l(2)4845 antikoerper, l(2)k00208 antikoerper, l(2)k08121 antikoerper, GB12654 antikoerper, dsim_GLEANR_9718 antikoerper, DsimGD25729 antikoerper, GD25729 antikoerper, EIF2C1 antikoerper, EIF2C antikoerper, GERP95 antikoerper, Q99 antikoerper, Eif2c1 antikoerper, ARGONAUTE 1 antikoerper, T1N15.2 antikoerper, T1N15_2 antikoerper, Argonaute-1 antikoerper, protein argonaute-2 antikoerper, argonaute 1 antikoerper, Argonaute 1 antikoerper, protein argonaute-1 antikoerper, argonaute 1, RISC catalytic component antikoerper, argonaute RISC catalytic subunit 1 antikoerper, Stabilizer of iron transporter SufD / Polynucleotidyl transferase antikoerper, AGO1 antikoerper, LOC552062 antikoerper, ago1 antikoerper, LOC659936 antikoerper, Dsim\AGO1 antikoerper, Ago1 antikoerper, LOC100386910 antikoerper, LOC100482671 antikoerper, LOC475337 antikoerper

Hintergrund: This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.

UniProt: Q9UL18

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization