FUS Antikörper

Produktnummer ABIN5518993

Produktdetails anti-FUS Antikörper

Target: FUS (Fused in Sarcoma (FUS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FUS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for TLS / FUS detection. Tested with WB in Human,Mouse,Rat.

Sequenz: DNNTIFVQGL GENVTIESVA DYFKQIGIIK TNKKT

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for TLS / FUS detection. Tested with WB in Human,Mouse,Rat.
Gene Name: FUS RNA binding protein
Protein Name: RNA-binding protein FUS

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FUS

Target: FUS (Fused in Sarcoma (FUS))

Andere Bezeichnung: FUS (FUS Produkte)

Synonyme: ALS6 antikoerper, ETM4 antikoerper, FUS1 antikoerper, HNRNPP2 antikoerper, POMP75 antikoerper, TLS antikoerper, D430004D17Rik antikoerper, D930039C12Rik antikoerper, Fus1 antikoerper, Tls antikoerper, FUS/TLS antikoerper, FUS RNA binding protein antikoerper, fused in sarcoma antikoerper, FUS antikoerper, Fus antikoerper

Substanzklasse: Viral Protein

Hintergrund: RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma) is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Synonyms: RNA-binding protein FUS, 75 kDa DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein, FUS, TLS

Gen-ID: 2521

UniProt: P35637